Miniature Fantasy Maps

Miniature Fantasy Maps - 1

Peso

27g

Tiempo

3h 57m

Precio

Cotiza este producto por WhatsApp

Contáctanos y te damos el precio según color y acabado

Pedir por WhatsApp

Las dimensiones dependen del diseño. Confirmamos las medidas exactas por WhatsApp.

Ver en MakerWorld

Descripción

Miniature Fantasy Maps – 8 Map Designs Bring maps, quests and exploration directly into your tabletop world with this collection of 8 highly detailed miniature fantasy maps. Each map has its own shape, theme and style. Instead of simply using flat printed graphics, the landscapes and symbols are represented as raised 3D details, making the maps clearly recognizable as miniature objects and allowing the details to remain visible after FDM printing. The set includes: Framed Coastal Map – lighthouse, rocky coastline, ships and compass Aged Coastal Map – weathered map with lighthouse, cliffs and ocean scenery Tropical Island Map – palms, mountains, coastlines and a marked treasure location Framed Kingdom Map – settlements, mountains, forests and fantasy landscape Dragon & City Map – fantasy city with a large raised dragon motif Treasure Island Map – tropical landscape, treasure route, skull and marked X Round Compass Map – circular map with raised terrain and cardinal directions World Map – continents, islands, oceans and compass symbol The collection combines different materials and map styles, including old parchment, wooden frames, scrolls and solid decorative map plaques. This makes it easy to use different designs for different locations and situations in your tabletop world. All important structures have been designed with FDM printing in mind. Mountains, buildings, trees, coastlines, compass symbols and other small elements use pronounced raised geometry so they remain readable as physical details rather than disappearing into a flat surface. Perfect for tabletop RPGs, treasure hunts, quests, campaigns, taverns, wizard rooms, libraries, cartographer shops, adventure scenes, dioramas and fantasy terrain decoration. Use them as maps lying on tables, hanging on walls, stored inside a wizard's study or as important quest items your adventurers discover during their journey. Eight maps, eight different worlds to explore – small details for much bigger adventures.   Viel Spaß       Weitere Accessoires für Tabletop, Dioramen und Gelände finden Sie in meiner Sammlung :   https://makerworld.com/en/collections/14795620-terrain-accessories  

Tags

dndtabletopterraindioramawargamingttrpgrpgfantasypathfindermap

Diseñador

StoneRock

Me gusta
18
Descargas
1
Impresiones
3